Cute Mother and Baby Elephant Necklace with Moissanite

Regular price £1,153.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Symbol of Commitment

The certified cushion cut diamond knot promise ring is designed to represent connection and enduring intention. Its knot-inspired form reflects unity, making it a thoughtful choice for marking a promise, milestone, or personal commitment.

Centered with a cushion cut diamond, this ring balances softness in shape with structured brilliance, creating a refined piece suited for everyday wear.

Knot Design with Purpose

The knot motif is integrated into the setting to symbolize continuity and strength. Beyond symbolism, the interwoven structure creates visual depth while keeping the center stone securely positioned.

The overall profile is composed to maintain comfort and proportion, allowing the ring to sit naturally on the finger without overwhelming the hand.

Certified Cushion Cut Diamond

The center stone is a certified cushion cut diamond, selected for its balanced proportions and soft, rounded corners. Certification confirms the diamond’s evaluated characteristics according to recognized grading standards.

Cushion cuts are appreciated for their blend of traditional shape and modern light performance, making them suitable for daily promise ring wear when properly cared for.

High-Level Features

  • Certified cushion cut diamond center stone
  • Symbolic knot-inspired setting
  • Designed for promise and commitment occasions
  • Balanced silhouette for everyday styling
Product Information
SKU SHP-PENDANT022151252
Length 12.6 mm
Width 20.5 mm
Metal Weight 5.00 gm (Approximate)
Total Stone Weight 0.20 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 19 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-3 Pcs
Round-1.20X1.20 mm-9 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1X1 mm-5 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces
What does the knot design symbolize?
The knot motif commonly represents unity, connection, and enduring bonds, making it a meaningful choice for a promise ring.
What does certified diamond mean?
A certified diamond has been evaluated and graded by a recognized gemological laboratory, confirming its characteristics according to established standards.
Is a cushion cut diamond suitable for daily wear?
Cushion cut diamonds are durable and, when set securely, can be suitable for daily wear as a promise ring.
Is this product sold as a single ring?
This listing is for a single promise ring. Please review the product detail tables for complete information about what is included.
Can this promise ring be worn as a stacking ring?
Many promise rings can be styled alone or paired with other bands, depending on personal preference and the ring’s setting profile.