Designer Lab Grown Orange Sapphire Stud Earrings with Diamond

Regular price £688.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance your jewelry collection with the natural beauty of these exquisite Lab Created Orange Sapphire Stud Earrings. Curated with a 5 MM round shape orange sapphire (lab created), elegantly set in prong setting. What truly sets these Designer Stud Earrings apart is the leaf-inspired frame that encircles each sapphire, offering a delicate and artistic design that brings a fresh and sophisticated twist to a timeless style. The leaf motif is embellished with tiny diamonds that glimmer gently, providing just the right touch of sparkle. This design gives the Petal Earrings a distinctive and elegant charm, ideal for anyone who appreciates beauty with a hint of surprise. With a secure screw back closure, these Orange Sapphire and Diamond Earrings fit comfortably, making them suitable for everyday wear or special events. The blend of premium AAAA quality lab made orange sapphire, dazzling HI-SI quality diamonds, and the elegant leaf shape results in a look that is both striking and meaningful. Packaged in a beautiful jewelry box, these Orange Stone Earrings offer a unique way to infuse color, sparkle, and style into any outfit.

Product Information
SKU SHP-EARRINGS082310492
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 1.65 Carat (Approximate)
LAB CREATED ORANGE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 1.30 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-orange-sapphire-earrings