Diamond Lotus Earring for Cartilage Piercing

Regular price £405.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enter into the magical world of brilliance with our Diamond Lotus Earring. This stud showcases Authentically Certified Diamonds secured in Prong Setting on a metal lotus flower motif. Whether you wear this Diamond Floral Earring on your Helix, Conch, High Lobe, Cartilage, or Conch Piercing. Youll steal the spotlight of any event. Ready to steal the spotlight then Style this amazing Lotus Earring with your OOTD and make everyone a fan of your sweet style and charm. Surprise your special one with a perfect gift that she will surely adore for her whole life, as it makes a perfect birthday, anniversary, or graduation gift.

Product Information
SKU SHP-BODYJ022410047
Metal Weight 0.85 gm (Approximate)
Total Stone Weight 0.33 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.33 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-2 Pcs
Round-2.40X2.40 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More