Diamond Twin Infinity Stud Earring

0
Regular price £678.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Double the charm, double the confidence - these Infinity Stud Earrings are not just pretty, they are powerful. These stunning Diamond Infinity Earrings are a perfect representation of everlasting beauty and infinite love. The design showcases a sparkling twin infinity motif that intertwines to form an elegant appearance, adorned with diamonds set in prongs. Crafted for both comfort and safety, the screw-back closure guarantees a secure and easy fit for these Diamond Stud Earrings, making them perfect for daily use or special events. You can give these Twin Infinity Earrings as a heartfelt gift or as a personal expression of timeless elegance; they are a cherished treasure for a lifetime. Whether worn with your favorite everyday looks or reserved for special occasions, these Womens Diamond Earrings bring effortless elegance and a message that lasts a lifetime. After all, some connections are too strong to be expressed by just one infinity - so why not wear two? Let your ears shine with this double powerful symbol of forever.

Product Information
SKU SHP-EARRINGS042159249
Length 7.4 mm
Width 12 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.13 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 32 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-32 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
infinity-jewelry