Emerald and Moissanite Twin Open Heart Necklace in Gold

Regular price £853.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Twin Open Heart Necklace with Emerald and Moissanite

This necklace features a twin open heart design accented with emerald and moissanite gemstones. The intertwined hearts create a symbolic and elegant focal point, while the gemstones add color and brilliance to the overall composition.

Open heart jewelry is widely appreciated for its expressive design and balanced structure. The two hearts appear connected within the pendant, creating a visual representation of unity and affection.

Symbolic Twin Heart Design

The twin open heart motif is often associated with emotional connection and meaningful relationships. Jewelry incorporating heart shapes is frequently chosen as a thoughtful gift to mark special occasions or personal milestones.

The open structure of the design introduces lightness and movement while allowing the gemstones to remain visually prominent within the pendant.

Emerald and Moissanite Gemstone Pairing

Emerald introduces a rich green color that contrasts beautifully with the bright sparkle of moissanite. This combination creates visual balance between vibrant color and light reflection within the pendant design.

Moissanite is created without traditional mining, though environmental impact can vary depending on manufacturing processes and energy sources.

A Meaningful and Elegant Necklace

Heart-shaped jewelry has remained a timeless design choice due to its emotional symbolism and classic aesthetic. The twin heart motif allows the necklace to express connection while maintaining a refined jewelry style.

With the addition of emerald color and moissanite brilliance, this necklace presents a graceful balance between symbolism and gemstone beauty.

Product Information
SKU SHP-PENDANT082210232
Weight 2.48 gm (Approximate)
EMERALD INFORMATION
No.of Stones 7 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-1 Pcs
Round-2X2 mm-6 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.42 Carat (Approximate)
Dimension(approx) Round-2X2 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
heart-necklaces

FAQs About: Emerald and Moissanite Twin Open Heart Necklace in Gold

What does a twin heart necklace symbolize?
A twin heart necklace is often associated with connection, love, and unity. The two hearts represent a bond between two individuals or meaningful relationships.
What gemstone is emerald?
Emerald is a green variety of the mineral beryl and is widely recognized for its vibrant color and historical use in fine jewelry.
What is moissanite in jewelry?
Moissanite is a gemstone known for its brilliance and light reflection. It is produced in laboratory conditions and commonly used in modern jewelry designs.
Is a heart necklace suitable as a gift?
Heart necklaces are frequently chosen as gifts because the heart symbol represents affection, connection, and meaningful relationships.
Can gemstone necklaces be worn daily?
Many gemstone necklaces are designed for everyday wear depending on their structure and how they are cared for during regular use.