IGI Certified 2 Carat Lab Grown Diamond Lotus Engagement Ring

Regular price £1,090.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate your timeless love with this exquisite Round Engagement Ring, skillfully made from precious metal. At its heart, an 8 MM Round Shape Lab Grown Diamond is elegantly set in a delicate Lotus Basket Setting, resting gracefully on a straight shank for a classic and sophisticated appearance. The lotus motif represents purity, new beginnings, and spiritual growth, making this Lab Grown Diamond Engagement Ring a significant choice for your special commitment. This 2 Carat Diamond Ring for Women showcases IGI Certified E Color and VS1 Clarity Stones, renowned for their remarkable brilliance and clarity, providing a dazzling sparkle like no other. Crafted to be stylish, this Man Made Diamond Ring for Engagement is ideal for daily wear or those unforgettable occasions. Whether presented as an engagement piece or a promise of forever, this Diamond Lotus Ring will undoubtedly be treasured by her for a lifetime, acting as a beautiful emblem of your profound and lasting love. This Solitaire Engagement Ring arrives in a beautifully designed jewelry box, perfect for gifting and safekeeping. Available in multiple ring sizes, metal colors, and purity options, this piece can be tailored to suit her unique style and your love story.

Design Inspiration

Drawing from the symbolic beauty of the lotus, this ring is designed with a round lab-grown diamond at its heart, elevated by petal-inspired elements that create a soft, blooming silhouette. The structure reflects layers of thoughtful craftsmanship, where each curve enhances the central stone’s brilliance while adding depth and dimension. Blending nature-inspired artistry with fine diamond detailing, the design captures a sense of renewal and elegance, resulting in a distinctive engagement ring with graceful visual storytelling.

Product Information
SKU SHP-RINGS012610052
Weight 2.60 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 2.04 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color E
Cut Brilliant
Shape Round
Setting Type Lotus-Basket-Setting
Quality Grade VS1
View More

Product Parent Collection Handle
igi-certified-diamonds