Lab Created Emerald Infinity Promise Ring With Diamond

Regular price £970.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This promise ring features a lab created emerald paired with a delicate infinity-inspired design accented by a diamond. The emerald provides a vibrant green focal point, while the infinity motif adds symbolic meaning to the overall design.

Promise rings are often chosen to represent commitment or meaningful milestones in a relationship. The combination of a distinctive gemstone and symbolic design elements creates a piece that reflects both personal sentiment and refined style.

Infinity-Inspired Ring Design

The infinity motif is widely recognized as a symbol of continuity and enduring connection. In jewelry design, this motif is often incorporated into rings to represent lasting bonds or meaningful commitments.

Within this ring, the infinity structure frames the gemstone while adding graceful curves that contribute to the ring’s visual balance and decorative character.

Lab Created Emerald Center Stone

Lab created emeralds are produced in controlled environments that replicate the conditions under which natural emeralds form. These gemstones share the same chemical and physical characteristics associated with emerald gemstones.

They are created without traditional mining, though the environmental impact may vary depending on production processes and energy sources.

Emerald and Diamond Combination

The pairing of emerald and diamond brings together vibrant color and bright contrast. Emerald gemstones introduce a rich green tone, while diamonds add subtle brilliance to complement the center stone.

This combination creates a balanced design in which the emerald remains the primary focus while the diamond accent enhances the ring’s overall visual appeal.

Product Information
SKU SHP-RINGS112310089
Metal Weight 3.80 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-34 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Lab Created Emerald Infinity Promise Ring With Diamond

What does the infinity symbol mean in a ring?
The infinity symbol is commonly associated with continuity, lasting connection, and enduring commitment.
What is a promise ring?
A promise ring is typically given to represent commitment, personal milestones, or meaningful relationships between two people.
What are lab created emeralds?
Lab created emeralds are gemstones grown in controlled environments that replicate natural emerald formation, resulting in similar chemical and physical properties.
Why are emerald gemstones used in rings?
Emeralds are valued for their rich green color and distinctive appearance, making them a popular gemstone choice for meaningful jewelry pieces.
Why are diamonds paired with colored gemstones?
Diamonds are often paired with colored gemstones to provide contrast and additional brilliance within a jewelry design.
Are gemstone promise rings suitable for everyday wear?
Gemstone promise rings can be worn regularly with proper care, though durability may vary depending on the gemstone and ring design.