Mama Bird Necklace with Pave Set Moissanite

Regular price £1,116.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Mama Bird Moissanite Necklace

This mama bird necklace features a symbolic bird design accented with pave set moissanite stones. The piece reflects a gentle and meaningful theme often associated with care, protection, and family bonds.

Nature-inspired necklaces like this are often chosen as sentimental jewelry pieces, making them suitable for personal wear or thoughtful gifting.

Nature-Inspired Pendant Design

The pendant draws inspiration from the imagery of a mother bird, a motif that represents nurturing and connection. Jewelry designs influenced by nature often use organic shapes and soft contours to create a balanced and graceful appearance.

This design captures that symbolism while maintaining a refined structure that suits everyday wear.

Pave Set Moissanite Stones

The necklace features moissanite gemstones arranged in a pave setting. In this style, small stones are placed closely together across the surface to create a continuous sparkle.

Moissanite gemstones are known for their strong brilliance and reflective qualities, helping the pendant capture and reflect light across its surface.

Meaningful and Versatile Jewelry

Symbolic necklaces are often chosen to represent meaningful relationships or personal milestones. The mama bird design adds emotional significance while remaining elegant and wearable.

This combination of symbolism and sparkle allows the necklace to function both as a personal keepsake and a decorative jewelry piece.

Product Information
SKU SHP-PENDANT012148748
Metal Weight 4.80 gm (Approximate)
Total Stone Weight 0.23 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 67 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1X1 mm-4 Pcs
Round-0.90X0.90 mm-42 Pcs
Round-0.80X0.80 mm-21 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Mama Bird Necklace with Pave Set Moissanite

What does a mama bird necklace symbolize?
A mama bird necklace often symbolizes nurturing, care, and the bond between family members.
What is a pave setting in jewelry?
A pave setting features small gemstones placed closely together across a surface, creating a continuous sparkling appearance.
What is moissanite used for in jewelry?
Moissanite is used in jewelry because of its strong brilliance and light reflection, making it a popular gemstone for decorative designs.
Is nature-inspired jewelry popular?
Nature-inspired jewelry is popular because it incorporates organic shapes and symbolic motifs drawn from elements found in nature.
Can this necklace be worn daily?
Symbolic necklaces with simple structures are commonly worn daily and can complement both casual and formal outfits.