Marquise Ruby Lotus Earring for Helix Piercing

Regular price £432.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Refined Detail for Helix Styling

The Marquise Ruby Lotus Earring for Helix Piercing is designed for those who prefer subtle yet distinctive jewelry for curated ear looks. Its compact structure makes it suitable for helix placement while maintaining a refined visual presence.

The design balances decorative detail with a size that supports everyday wear.

Lotus-Inspired Design with Structured Form

The lotus-inspired motif is created using marquise-shaped elements, forming a balanced and symmetrical arrangement. This structure adds visual depth while keeping the overall design clean and wearable.

The setting is crafted to hold the stones securely, supporting stability in a helix piercing position.

Ruby for Distinctive Color

Ruby is valued for its deep red hue, offering a strong yet elegant contrast against metal settings. It is generally suitable for regular wear with mindful care.

Its rich color allows the earring to stand out while remaining refined in smaller designs.

High-Level Features Buyers Appreciate

The compact size and structured design make it well-suited for helix piercings, supporting a comfortable and secure fit. Its floral-inspired form adds detail without overwhelming the ear stack.

It pairs easily with other earrings, allowing for flexible styling across multiple piercings.

Product Information
SKU SHP-BODYJ022410054
Weight 0.81 gm (Approximate)
Center Stone Weight 0.20 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-1 Pcs
Color Red
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Marquise Ruby Lotus Earring for Helix Piercing

What is a helix earring?
A helix earring is designed to be worn on the upper cartilage of the ear, requiring a secure and comfortable fit.
Is this earring suitable for daily wear?
Yes, its compact and secure design makes it suitable for regular wear with proper care.
What does a marquise shape mean?
A marquise shape is an elongated stone with pointed ends, often used to create elegant and leaf-like designs.
Can this earring be worn in other piercings?
It may be worn in other compatible piercings depending on size and fit, though it is primarily designed for helix placement.
Is ruby suitable for everyday wear?
Ruby is generally suitable for daily wear, though careful handling helps maintain its appearance over time.
Who is this earring ideal for?
It is ideal for individuals who want a detailed yet compact piece for curated ear styling.