Minimalist Diamond Bar Earring for Helix Piercing

Regular price £344.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Minimalist Diamond Bar Earring for Helix Piercing is made for the kind of sparkle that feels effortless, personal, and easy to wear every day. Designed as a single piercing earring, it features a slim bar motif set with petite round diamonds, giving your helix, cartilage, or upper lobe a clean line of brilliance without overwhelming your ear stack.

Its flat back closure makes the design practical for piercing jewelry, while the diamond bar shape keeps the look polished and modern. Whether chosen as a self-gift, birthday surprise, graduation gift, anniversary present, or a refined upgrade to an existing ear curation, this diamond helix earring adds a precise touch of shine with a minimal profile.

Diamond Bar Helix Earring with Flat Back Closure

This diamond bar earring is crafted in solid metal and features 24 round brilliant cut diamonds totaling approximately 0.24 carat. The diamonds are set along a sleek bar motif with a prong setting, creating a fine line of sparkle for helix, cartilage, or upper lobe placement. It is sold singly and available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, with flat back post length options from 4.5 MM to 7.5 MM.

What Makes This Special

  • Minimalist diamond bar earring designed for helix, cartilage, or upper lobe piercing.
  • Features 24 round diamonds arranged along a slim bar motif.
  • Total diamond weight is approximately 0.24 carat.
  • Each diamond measures approximately 1.10X1.10 mm.
  • Diamonds are listed as HI color and SI quality grade with brilliant cut detailing.
  • Prong setting helps present each petite diamond clearly along the bar design.
  • Flat back closure supports secure, comfortable piercing wear.
  • Sold singly, with left ear and right ear selection available.
  • Approximate earring weight is 0.45 gm.
  • Available in 10K, 14K, and 18K yellow or white gold options.

Why Choose This Design

The bar silhouette gives this earring a crisp, intentional look that works beautifully in curated ear styling. Instead of a single-stone stud, the design creates a short line of diamond sparkle, making it visible enough to stand out while still keeping a refined, low-profile feel.

The flat back closure is especially useful for helix and cartilage placements because it sits more smoothly behind the ear than a traditional post back. With multiple flat back post length options, the earring can be selected to better suit the piercing placement and preferred fit. The diamond arrangement also makes it easy to pair with studs, hoops, huggies, or other cartilage jewelry without making the ear stack feel crowded.

Design Meaning

The slim bar design gives the earring a clean, intentional look. Its row of diamonds adds subtle brightness, making it meaningful for everyday styling, new piercings, or milestone gifting.

Because it is designed for helix, cartilage, or upper lobe placement, the earring also becomes part of a personal ear story. It can mark a new piercing, a style refresh, or a gift chosen to celebrate someone’s individuality in a subtle yet sparkling way.

Authenticity & Craftsmanship

This earring is presented as certified jewelry, crafted in precious metal, and checked by hand. The product specifications list 24 round brilliant cut diamonds with an approximate total weight of 0.24 carat, HI color, SI quality grade, and prong setting.

The earring is made to order and crafted with a flat back closure for piercing wear. Each petite diamond is arranged along the bar motif to create a clean, aligned sparkle, while the solid metal construction supports a premium finish suitable for regular styling.

Style and Wearability

From the front, the diamond bar creates a fine, sparkling line that follows the ear with a clean minimalist effect. From the side, the flat back design helps keep the earring comfortable and secure, making it well suited to helix, cartilage, and upper lobe placements.

Wear it alone for a refined piercing accent or combine it with small hoops, diamond studs, or other body jewelry for a curated ear stack. Yellow gold options add warmth to the diamond sparkle, while white gold options create a crisp, bright look. Since the earring is sold singly with left or right ear selection, it can be chosen precisely for the placement and styling plan you have in mind.

Product Information
SKU SHP-BODYJ082410133
Weight 0.45 gm (Approximate)
Center Stone Weight 0.24 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-24 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Minimalist Diamond Bar Earring for Helix Piercing

Is this diamond bar earring suitable for a helix piercing?

Yes. This earring is designed for helix, cartilage, or upper lobe placement and comes with a flat back closure, making it a practical choice for piercing jewelry with a smooth, secure fit.

How many diamonds are used in this earring?

The earring features 24 round diamonds arranged along the bar motif. The total diamond weight is approximately 0.24 carat, and each diamond measures approximately 1.10X1.10 mm.

What diamond quality is listed for this helix earring?

The diamonds are listed as HI color and SI quality grade with brilliant cut detailing. They are round in shape and arranged in a prong setting along the bar design.

Is this earring sold as a pair or a single piece?

This diamond bar earring is sold singly. The product page also provides left ear and right ear selection, helping buyers choose the piece for the intended piercing placement.

What metal options are available for this diamond bar earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. These options allow buyers to choose a warm yellow gold tone or a bright white gold finish.

What post length options are available?

The flat back post length options shown on the product page include 4.5 MM, 5.0 MM, 5.5 MM, 6.0 MM, 6.5 MM, 7.0 MM, and 7.5 MM. These options help buyers select a length that suits their piercing placement and comfort needs.

How should I care for this diamond helix earring?

Clean the earring gently with mild soap, warm water, and a soft brush, then dry it with a lint-free cloth. Avoid harsh chemicals and store it separately when not in use. For piercing wear, keep the flat back and post clean and ensure the closure is secure before wearing.