Natural Aquamarine Diamond Flower Promise Ring with Certificate

Regular price £779.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Natural Aquamarine Flower Promise Ring

This Natural Aquamarine Diamond Flower Promise Ring combines gentle gemstone color with a delicate floral design. The aquamarine gemstone creates a soft blue focal point that brings a calm and elegant presence to the ring.

Diamond accents complement the center stone with subtle brilliance, enhancing the floral motif while maintaining a refined and balanced appearance.

A Floral Inspired Ring Design

Floral motifs have long been used in jewelry to represent beauty and natural elegance. In this design, the arrangement of gemstones creates a flower-like composition that highlights the center aquamarine.

The structure of the ring balances decorative detail with a graceful silhouette, giving the piece a distinctive yet timeless character.

The Appeal of Natural Aquamarine

Aquamarine gemstones are admired for their clear blue color and luminous appearance. Their soft tone brings a sense of freshness and elegance to fine jewelry pieces.

When paired with diamonds, the gemstone’s color becomes more pronounced, creating a balanced combination of subtle color and sparkle.

A Meaningful Promise Ring

Promise rings are often chosen to symbolize commitment, milestones, or personal meaning. Designs featuring gemstones and floral motifs are especially appreciated for their expressive character.

With its aquamarine center stone, diamond accents, and flower-inspired design, this ring offers a graceful piece suited for meaningful gifting or everyday elegance.

Product Information
SKU SHP-RINGS0821234983
Width 8.5 mm
Height 2.5 mm
Metal Weight 2.38 gm (Approximate)
Total Stone Weight 0.41 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-rings

FAQs About: Natural Aquamarine Diamond Flower Promise Ring with Certificate

What is a promise ring?
A promise ring is a piece of jewelry given to symbolize commitment, affection, or a meaningful milestone between individuals.
What makes aquamarine popular in jewelry?
Aquamarine is appreciated for its light blue color and clarity. Its calm tone gives jewelry a fresh and elegant appearance.
Why are diamonds used with aquamarine gemstones?
Diamonds are often used as accent stones because their brilliance enhances the appearance of the center gemstone while adding additional sparkle.
What does a floral ring design represent?
Floral ring designs often represent beauty, growth, and natural elegance. These motifs are frequently used in jewelry to create delicate and expressive styles.
Can promise rings be worn daily?
Many promise rings are suitable for everyday wear when handled with care to maintain the appearance of the gemstone and metal setting.
Is aquamarine used in promise rings?
Aquamarine is often chosen for promise rings because of its elegant blue color and refined appearance in gemstone jewelry.