Natural Black Onyx Infinity Earrings with Screw Back

Regular price £563.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Symbolic Design with Modern Simplicity

These natural black onyx infinity earrings are designed for those who value meaning as much as style. The infinity motif represents continuity and connection, making them a thoughtful choice for everyday wear or meaningful gifting.

Their clean yet expressive form allows them to stand out subtly, offering a refined balance between symbolism and wearable design.

Infinity Motif with Structured Form

The infinity shape is carefully structured to maintain symmetry and proportion, ensuring a visually balanced look when worn. This design approach keeps the earrings versatile, making them suitable for both casual and formal styling.

Unlike more intricate statement pieces, the form remains streamlined while still carrying distinct visual identity.

Natural Black Onyx for Bold Contrast

Black onyx is chosen for its deep, uniform color, which adds contrast and definition to the overall design. Its smooth surface complements the clean lines of the infinity motif, creating a polished appearance.

The stone works well for those who prefer understated yet impactful jewelry that pairs easily with different outfits.

Secure Screw Back for Everyday Confidence

The screw back closure is designed to provide added security, helping the earrings stay in place throughout the day. This makes them suitable for regular use without the need for frequent adjustment.

It also offers reassurance for those who prioritize a more secure fastening style in their jewelry.

Comfortable Wear with Balanced Structure

The earrings are crafted to sit comfortably on the ear, with attention given to how they feel during extended wear. Their balanced structure supports ease of use while maintaining their intended design.

This makes them a practical addition to a daily jewelry rotation.

A Versatile Choice with Meaningful Appeal

These earrings are ideal for individuals seeking jewelry that combines symbolism with simplicity. The infinity design and black onyx pairing create a look that is both timeless and adaptable.

They transition easily between everyday wear and occasion styling, making them a versatile and meaningful accessory.

Product Information
SKU SHP-EARRINGS042158217
Weight 1.80 gm (Approximate)
Center Stone Weight 0.88 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 4 Pieces
Total Weight 0.88 Carat (Approximate)
Dimension(approx) Round-4X4 mm-4 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-onyx-earrings

Faq About: Natural Black Onyx Infinity Earrings with Screw Back

Are screw back earrings secure for daily wear?
Yes, screw back closures are designed to provide a secure fit, helping keep the earrings in place during regular use.
Is black onyx suitable for everyday jewelry?
Black onyx is commonly used in everyday jewelry due to its smooth finish and consistent appearance.
What does the infinity design represent?
The infinity symbol is often associated with continuity, connection, and timeless meaning.
Are these earrings comfortable for long wear?
Yes, they are designed with a balanced structure to support comfortable wear throughout the day.
Can these earrings be worn for formal occasions?
Yes, their clean design and bold contrast make them suitable for both formal and everyday styling.
How should these earrings be maintained?
Regular cleaning and proper storage help preserve their appearance and maintain the finish over time.