Natural Garnet Diamond Flower Engagement Ring Wedding Band Set

Regular price £1,243.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Uniquely designed with romance and elegance in mind, this Garnet Wedding Ring Set is a breathtaking expression of love. The set includes a stunning Flower Engagement Ring, featuring a 6 mm Princess Cut Garnet placed diagonally, beautifully complemented by a flower motif adorned with sparkling Diamond stones. The band itself is lined with precious Diamond gemstones, adding an extra touch of shimmer and sophistication. Completing the ensemble is a gracefully Curved Wedding Band adorned with round Diamonds, designed to perfectly hug the engagement ring and create a harmonious, sparkling union. The deep red AAA Quality Garnet symbolizes passion and devotion, while the HI-SI Quality Diamond add a brilliant sparkle that captures light from every angle, reflecting the depth and beauty of your love story. Crafted with care and available in various ring sizes, this Wedding Bridal Ring Set ensures a comfortable and perfect fit for her hand. Arriving in a signature jewelry box, this Wedding Engagement Ring Set is ready to gift and makes an unforgettable choice for engagements, weddings, anniversaries or any moment meant to celebrate eternal love.

Product Information
SKU SHP-RINGS032228792
Metal Weight 2.88 gm (Approximate)
Center Stone Weight 1.40 Carat (Approximate)
GARNET INFORMATION
No.of Stones 1 Pieces
Total Weight 1.40 Carat (Approximate)
Dimension(approx) Princess Cut-6X6 mm-1 Pcs
Color Red
Cut Brilliant
Shape Princess Cut
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 47 Pieces
Total Weight 0.62 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-24 Pcs
Round-1.30X1.30 mm-18 Pcs
Round-1.50X1.50 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
garnet-women-wedding-bands