Natural Princess Cut Diamond Flower Engagement Ring with Crossover Shank

Regular price £1,926.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom with a love that feels fresh, joyful and endlessly beautiful through this Flower Engagement Ring. Inspired by nature and romance, the design features a striking 4 mm Princess Cut Diamond at the center of a Flower motif, symbolizing a love that continues to grow. Petite Diamond stones surround the center stone like soft petals, adding sparkle that feels gentle yet captivating. The Crossover Shank, also adorned with shimmering Diamond stones, wraps gracefully around the finger, representing two lives meeting and moving forward together. It catches the light beautifully, making every glance a reminder of a promise made from the heart. This Diamond Flower Ring is perfect for someone who loves elegance with a touch of creativity and romance with meaning behind it. Whether it marks the beginning of forever or celebrates a love already in full bloom, it speaks without saying a word. Presented in a signature jewelry box, the moment feels special from the very start. Available in various ring sizes, this Diamond Engagement Ring is made to fit perfectly, just like your love story, meant to last forever.

Product Information
SKU SHP-RINGS042210196
Metal Weight 2.40 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 69 Pieces
Total Weight 0.77 Carat (Approximate)
Dimension(approx) Princess Cut-4X4 mm-1 Pcs
Round-0.80X0.80 mm-18 Pcs
Round-1X1 mm-50 Pcs
Color HI
Cut Brilliant
Shape Princess Cut, Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings