Natural Ruby Heart Promise Ring with Diamond Split Shank

Regular price £852.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Adorn her finger with a promise that speaks louder than words, a symbol of love, loyalty and a future written together. This Ruby Promise Ring captures romance in its purest form, with a glowing 3 mm Round Shape Ruby resting at the center of a graceful Heart motif. The AAA Quality Ruby, long known as a stone of passion and devotion, reflects the deep connection you share, while the Split Shank sparkles with Lab Grown Diamond stones that add a soft, radiant charm from every angle. This Ruby Heart Ring represents a meaningful step, a quiet yet powerful vow of commitment, whether it marks the beginning of a journey or celebrates a bond that continues to grow stronger each day. This Ruby Diamond Ring beautifully expresses that intention, making it perfect for moments when words are not enough. Thoughtfully designed and presented in a signature jewelry box, this Commitment Ring arrives ready to surprise and delight. With multiple ring sizes available, this Ruby Ring for Women is easy to find the perfect fit. Elegant yet modern, it is a lasting reminder of love, devotion and everything still to come.

Product Information
SKU SHP-RINGS022510056
Metal Weight 2.40 gm (Approximate)
Total Stone Weight 0.38 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 25 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-25 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More