Nature Inspired Certified Diamond Flower Earring for Helix Piercing

Regular price £378.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

A petite flower made for a curated ear, this diamond helix earring brings nature-inspired charm to cartilage styling without feeling heavy or overdone. Its four-petal floral form is shaped in solid precious metal and finished with round brilliant diamonds for a soft, sparkling accent. Designed as a single earring, it offers a meaningful way to mark a birthday, anniversary, graduation, or personal style moment with a piece that feels delicate, expressive, and easy to wear.

Certified Round Diamond Flower Helix Earring with Flat Back

This flower stud earring is designed for helix, cartilage, tragus, conch, and upper lobe piercings. The 6.7 mm floral motif holds 4 round brilliant diamonds in prong settings, with an approximate total diamond weight of 0.14 carat. Its flat back closure helps the earring sit securely and comfortably, while selectable post lengths make it easier to choose a fit for different piercing placements.

What Makes This Special

The floral design measures approximately 6.7 mm in length and 6.7 mm in width, with an approximate height of 2 mm. Its scale makes it noticeable enough to add sparkle while still refined for a curated ear stack.

Four round diamonds, each approximately 1.80 x 1.80 mm, are placed in prong settings to form the center of the flower design. The diamond options include lab diamond quality of EF-VS and natural diamond quality of HI-SI, allowing buyers to select the stone preference that suits their style and budget.

The earring weighs approximately 0.63 gram and is sold singly. It is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, with flat back post length options from 4.5 mm to 7.5 mm.

Why Choose This Design

A flower shape brings softness to cartilage jewelry, while the diamond placement adds just enough brilliance for a polished finish. The round brilliant cut supports lively sparkle in a compact surface area, and the prong setting keeps the stones visible while holding them securely in place.

The flat back closure is especially practical for helix and cartilage wear because it creates a smoother finish behind the ear than a traditional post back. Left ear and right ear options help align the design with the chosen piercing placement, making it a thoughtful choice for anyone building a balanced ear stack.

Design Meaning

The four-petal flower design carries a gentle sense of growth, affection, renewal, and everyday joy. It is a fitting gift for someone who loves botanical jewelry or wants a piercing earring with a softer, more personal expression. The diamond accents add a celebratory touch, making the piece suitable for milestones that deserve something small in scale but rich in meaning.

Authenticity & Craftsmanship

Rosec Jewels crafts this diamond flower earring with attention to proportion, secure stone setting, and refined metal finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure the earring is prepared with care for its intended piercing placement. Rosec Jewels offers a Certificate of Authenticity with the product for added confidence. To care for it, keep the earring away from harsh chemicals, store it separately when not in use, and clean it gently with a soft cloth to help preserve its shine.

Style and Wearability

This single flower earring works beautifully as a delicate helix accent, a cartilage stud, or part of a layered ear look. It can be worn alone for a subtle nature-inspired statement or paired with hoops, studs, and other flat back earrings for a curated arrangement. The precious metal options make it easy to coordinate with existing jewelry, while the compact diamond flower design feels appropriate for both daily styling and meaningful gifting.

Product Information
SKU SHP-BODYJ082410037
Length 6.7 mm
Width 6.7 mm
Height 2 mm
Weight 0.63 gm (Approximate)
Center Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Nature Inspired Certified Diamond Flower Earring for Helix Piercing

What type of piercing is this diamond flower earring designed for?

This single flower stud earring can be worn on helix, cartilage, tragus, conch, and upper lobe piercings. It is designed with a flat back closure for a secure, smooth fit.

How many diamonds are used in this flower earring?

The earring is set with 4 round brilliant diamonds in prong settings. The diamonds have an approximate total weight of 0.14 carat, with each stone measuring approximately 1.80 x 1.80 mm.

What diamond quality options are available?

The earring is available with lab diamond quality of EF-VS or natural diamond quality of HI-SI. These options allow buyers to choose the diamond preference that best matches their budget and jewelry priorities.

Which metal choices are offered for this helix earring?

The earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. These options make it easy to match the piece with warm or cool-toned jewelry stacks.

Can I choose the post length and ear side?

Yes. The flat back post length can be selected from 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm. The earring also includes left ear and right ear selection for the intended piercing placement.

Is this earring sold as a pair or a single piece?

This diamond flower earring is sold singly. It is intended for curated ear styling, where a single helix, cartilage, tragus, conch, or upper lobe accent can be mixed with other earrings.

Does this diamond earring come with authenticity assurance?

Rosec Jewels offers a Certificate of Authenticity with the earring. The piece is also checked by hand, including stone inspection, setting security review, and finishing inspection before dispatch.