Nature Inspired Floral Ring with Pink Tourmaline and Diamond

Regular price £1,322.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

A tender tribute to nature and romance, this floral ring brings together the soft pink glow of Pink Tourmaline with the refined sparkle of Diamond accents. At the center, a 5 MM round Pink Tourmaline rests above a flower-inspired design, creating a graceful focal point with a poetic, garden-like charm. Designed for proposals, meaningful gifting, anniversaries, or a personal milestone, this ring feels expressive without being overly ornate.

Natural Pink Tourmaline Flower Inspired Ring With Diamond Accent

This Pink Tourmaline and Diamond ring is crafted with one brilliant-cut round Pink Tourmaline of approximately 0.45 carat and six brilliant-cut round Diamonds totaling approximately 0.64 carat. The center gemstone is secured in a prong setting, while a trio of Diamonds on each side adds balanced sparkle around the floral motif. Available in 92.5 Sterling Silver, 10K White Gold, 10K Yellow Gold, 14K White Gold, 14K Yellow Gold, 18K White Gold, and 18K Yellow Gold, it offers a personalized metal choice for different styles and occasions.

What Makes This Special

The ring centers on a single round Pink Tourmaline in AAA quality, chosen in a soft pink shade that gives the design its romantic character. Its brilliant cut helps the gemstone catch light from the top, while the prong setting keeps the look open and refined.

Six round Diamonds frame the flower-inspired design, with four Diamonds measuring approximately 2.40 MM and two Diamonds measuring approximately 3 MM. Their HI color and SI quality add a bright contrast to the pink center stone, giving the ring a fuller, more celebratory presence.

The floral layout gives the ring a distinctive identity, making it different from a classic solitaire while still keeping the center gemstone as the emotional focus.

Why Choose This Design

Pink Tourmaline is loved for its gentle color, making it a thoughtful choice for someone who prefers romantic gemstone jewelry over a traditional all-diamond ring. The round shape keeps the design soft and wearable, while the brilliant cut adds lively reflection without overwhelming the floral details.

The prong setting allows light to reach the gemstones, enhancing their brightness and giving the ring a lifted, dimensional look. Diamond accents on both sides help frame the center stone and bring balance to the design, so the ring feels polished from every viewing angle. With multiple precious metal options available, the same floral design can feel bright and modern in white metal or warmer and more classic in yellow gold.

Design Meaning

The flower-inspired motif gives this ring a deeply symbolic feeling. Flowers often represent growth, affection, renewal, and the beauty of a love that continues to bloom. Paired with Pink Tourmaline, the design carries a soft emotional tone, making it meaningful for a promise, proposal, anniversary, birthday, or a gift that celebrates a new chapter.

The Diamond trios on each side add a sense of harmony and support around the center gemstone, echoing the idea of love surrounded by care, sparkle, and lasting intention.

Authenticity & Craftsmanship

Rosec Jewels crafts this ring with careful attention to gemstone placement, setting security, and finishing detail. Each piece goes through stone inspection, a setting security review, and a final finishing inspection before dispatch, helping ensure the ring is prepared with confidence and care. A Certificate of Authenticity is offered with the jewelry for added assurance. To preserve its finish and gemstone sparkle, keep the ring away from harsh chemicals, store it separately when not worn, and clean it gently with a soft cloth as part of regular jewelry care.

Style and Wearability

This Pink Tourmaline ring brings color, sparkle, and symbolism into one wearable design. The round center stone gives the ring a soft focal point, while the side Diamonds add brilliance across the finger without making the profile feel heavy. It can be worn as a romantic engagement ring, a meaningful promise ring, or a distinctive gemstone ring for special occasions.

Its nature-inspired form pairs well with soft, feminine styling, occasion outfits, and everyday looks that call for a touch of color. The choice of sterling silver or gold tones also makes it easy to match with an existing jewelry wardrobe.

Product Information
SKU SHP-RINGS032220851
Weight 2.64 gm (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.64 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-4 Pcs
Round-3X3 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
pink-tourmaline-rings

FAQs About: Nature Inspired Floral Ring with Pink Tourmaline and Diamond

What makes this Pink Tourmaline floral ring suitable for a proposal or gift?

The soft pink center stone, flower-inspired design, and Diamond accents give this ring a romantic and meaningful feel. It is a thoughtful choice for a proposal, anniversary, promise, birthday, or milestone gift for someone who loves gemstone jewelry with symbolism.

What does the floral design symbolize?

The floral motif symbolizes love, growth, renewal, and affection. Combined with Pink Tourmaline, the design feels expressive and personal, making it well suited for celebrating a relationship, a new beginning, or a meaningful life moment.

What stone cut and setting style are used in this ring?

The ring features a brilliant-cut round Pink Tourmaline in a prong setting. The Diamond accents are also brilliant-cut round stones, secured in prong settings to enhance their sparkle and keep the design refined.

Does this ring include Diamond accent stones?

Yes. The design includes six round Diamond accent stones with an approximate total weight of 0.64 carat. A trio of Diamonds is placed on both sides of the flower-inspired detail, adding brightness around the Pink Tourmaline center stone.

What are the gemstone details of the Pink Tourmaline?

The center gemstone is one round Pink Tourmaline measuring approximately 5 MM by 5 MM, with an approximate weight of 0.45 carat. It has a brilliant cut, pink color, AAA quality grade, and prong setting.

Which metal options are available for this ring?

This ring is available in 92.5 Sterling Silver, 10K White Gold, 10K Yellow Gold, 14K White Gold, 14K Yellow Gold, 18K White Gold, and 18K Yellow Gold, allowing the design to be personalized in a bright white tone or a warmer yellow gold finish.

How should I care for this Pink Tourmaline and Diamond ring?

Store the ring separately when not in use, avoid harsh chemicals, and remove it during heavy work or activities that may cause impact. Clean it gently with a soft cloth to help maintain the shine of the metal and the sparkle of the gemstones.