Nature Inspired Half Carat Peridot Flower Engagement Ring with Diamond

Regular price £867.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A blooming promise of love and renewal, this Flower Engagement Ring is designed for a romance that grows brighter with time. At its center rests a 5 mm Round Shape Peridot, glowing in fresh green tones that symbolize new beginnings and devotion. The gemstone is framed in a delicate Flower motif, capturing the beauty of nature in full bloom and turning a timeless symbol of commitment into something truly unforgettable. The gracefully Curved Band is adorned with petite Diamond stones that add a soft, sparkling accent, catching the light with every movement and enhancing the elegant charm of this Peridot Engagement Ring. Thoughtfully crafted for comfort and style, this Peridot Diamond Ring blends modern romance with organic design, making it perfect for those who love meaningful details. Available in a range of metal options and ring sizes, this Peridot Ring for Women allows you to create a piece that reflects your unique love story. Presented in a signature jewelry box, this Nature Inspired Engagement Ring is ready to mark a moment that deserves to be cherished forever. Whether chosen for an engagement or a special declaration of love, this Peridot Flower Ring speaks of passion, growth and a future built together.

Product Information
SKU SHP-RINGS0821183115
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 0.54 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
peridot-engagement-rings