Princess Cut Amethyst Floral Engagement Ring with Diamond

Regular price £1,230.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral-Inspired Ring with Expressive Color

The Princess Cut Amethyst Floral Engagement Ring with Diamond is designed for those who appreciate nature-inspired details paired with a distinctive gemstone. The rich purple hue of the amethyst creates a strong focal point, while the floral motif adds a soft, artistic touch.

This combination offers a unique alternative to traditional engagement ring styles.

Floral Setting with Structured Elegance

The floral design is crafted to frame the princess-cut center stone, creating a balanced composition that blends structure with organic form. Diamond accents enhance the overall look, adding subtle brilliance that complements the central gemstone.

This thoughtful arrangement ensures visual harmony while highlighting the ring’s distinctive design.

Amethyst with Distinctive Appeal

Amethyst is known for its vibrant purple color and clarity, making it a popular choice for expressive jewelry. Its appearance offers a balance between bold color and refined elegance.

It is generally suitable for occasional to regular wear with proper care to maintain its surface over time.

High-Level Features Buyers Appreciate

The ring is designed to provide a comfortable fit while maintaining a detailed and structured setting. Its floral style allows it to stand out as a statement piece, while still pairing well with complementary bands.

The blend of vibrant color, nature-inspired design, and balanced proportions makes it suitable for both everyday styling and meaningful occasions.

Product Information
SKU SHP-RINGS032224054
Width 9.8 mm
Height 3.5 mm
Weight 2.96 gm (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.55 Carat (Approximate)
Dimension(approx) Princess Cut-5X5 mm-1 Pcs
Color Voilet
Cut Brilliant
Shape Princess Cut
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Round-1.80X1.80 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-engagement-rings

FAQs About: Princess Cut Amethyst Floral Engagement Ring with Diamond

Is amethyst suitable for everyday wear?
Amethyst can be worn regularly with proper care, though it is best handled mindfully to maintain its finish.
What makes the floral design unique?
The floral setting adds an organic and artistic element, creating a softer and more decorative appearance around the center stone.
Does the princess cut affect the ring’s look?
Yes, the princess cut provides a structured, modern shape that contrasts beautifully with the softer floral design.
Can this ring be paired with a wedding band?
Yes, it can be paired with compatible bands to create a complete bridal set.
Does the ring feel heavy on the finger?
No, the design is intended to maintain comfort while supporting the detailed setting.
Who is this ring ideal for?
It is ideal for those who prefer colorful gemstones combined with nature-inspired and detailed designs.