Real Blue Sapphire Diamond Flower Engagement Ring for Women

Regular price £905.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Unveil a story of love that blossoms in timeless elegance with this Flower Engagement Ring. At its center rests a 4 mm Round Shape Blue Sapphire set in Prong Setting, a gem long associated with loyalty, wisdom and deep emotional devotion, capturing the calm strength of a promise meant to last forever. Surrounding it, a Vintage Inspired Flower motif unfolds like a bloom at its peak, symbolizing beauty and a love that continues to evolve with time. Sparkling Diamond stones grace the petals and flow along the band, reflecting purity, clarity and the brilliance of shared dreams. Together, the AAA Quality Blue Sapphire and HI-SI Quality Diamond stones create a harmony that speaks without words, expressing a bond that is rare and enduring. Designed for special moments, this Blue Sapphire Diamond Ring is perfect as an engagement ring or a heartfelt gift that marks a meaningful chapter in life. This Blue Sapphire Flower Ring arrives in a signature jewelry box, ready to be presented with elegance and care and is available in multiple ring sizes to ensure the perfect match. This Blue Sapphire Engagement Ring is a symbol of commitment, a reminder of promises made and a celebration of two souls choosing forever in their own unique way. Its vintage charm makes every moment unforgettable and beautifully personal and truly timeless in meaning.

Product Information
SKU SHP-RINGS072210077
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.72 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.40X1.40 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-rings