Real Diamond Fish Earring for Tragus Piercing

Regular price £398.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Distinctive Accent for Curated Piercing Styles

The Unique Diamond Gold Fish Earring for Tragus Piercing is designed for those who prefer expressive details in compact forms. The fish-inspired shape introduces movement and character while maintaining a size suited for close-fitting piercings.

This piece is ideal for adding individuality to curated ear styling without overwhelming the overall look.

Why the Fish Design Works for Tragus Placement

The fish motif is shaped to sit neatly within the tragus area, offering a design that feels both decorative and proportionate. Its structure allows for visual detail while maintaining a low-profile form.

This balance helps ensure the earring remains comfortable while still standing out as a unique element.

Diamond Detail and Practical Wear

Diamonds add subtle brightness to the design, enhancing its shape without creating excess bulk. Their durability makes them suitable for jewelry intended for regular use in small piercings.

The combination of gold and diamond creates a refined contrast that supports both visual clarity and long-term wear.

High-Level Features Buyers Appreciate

The compact size ensures ease of wear, while the detailed design offers a distinctive look within a small form factor. It can be worn as a standalone piece or combined with other earrings for a layered style.

Its balance of structure and creativity makes it suitable for those who want something unique without sacrificing practicality.

Product Information
SKU SHP-BODYJ012210372
Weight 0.54 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-3 Pcs
Round-1X1 mm-7 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tragus-earrings

FAQs About: Unique Diamond Gold Fish Earring for Tragus Piercing

Is this earring designed specifically for tragus piercing?
Yes, its size and shape are intended to fit comfortably within the tragus area while maintaining a secure position.
Is it comfortable for daily wear?
The compact and low-profile design makes it suitable for everyday wear when used in a healed piercing.
Is this sold as a single earring or a pair?
Tragus earrings are often sold individually, but it is recommended to confirm this in the product details section.
Can this earring be worn in other piercings?
It may be worn in other ear piercings depending on fit, though it is specifically designed for the tragus.
Are diamonds suitable for piercing jewelry?
Diamonds are durable and maintain their appearance over time, making them a practical choice for everyday piercing jewelry.
Who is this earring best suited for?
It is ideal for those who prefer creative, nature-inspired designs that add personality to curated ear styling.