Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels
Round Cut Genuine Ruby Flower Promise Ring AAA - Rosec Jewels

Round Cut Genuine Ruby Flower Promise Ring

£893.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm
Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand
Drop Hint Email Call us
View details

Product Details

Drawing inspiration from the stunning beauty of nature, this Flower Promise Ring radiates grace and elegance. At its core is a 5 MM round cut real ruby, securely held in prong setting that allows its vibrant hue to shine. Flanking the ruby are metal petals surrounding the center gem to create a floral pattern, adding a touch of sparkle and natural charm. The floral motif gives this Ruby Proposal Ring a romantic vibe, making it ideal for anyone who adores jewelry inspired by the beauty of nature. The AAA quality ruby shines with a rich color, while the glowing metal provides bright and radiant brilliance that enhances the overall appearance. Together, they create a lovely balance of warmth and sparkle that catches the light with every movement. Meticulously crafted with care and precision, this Ruby Flower Ring is both timeless and contemporary, a piece that will always remain in style. It symbolizes love that flourishes and blooms, just like a flower. Elegant, meaningful, and full of charm, this Floral Ruby Ring is a wonderful way to celebrate life’s most beautiful moments.

Product Information
SKU SHP-RINGS082223756
Metal Weight 2.87 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
ruby-engagement-rings