Round Cut Natural Diamond Unique Stud Earrings

Regular price £795.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Made for moments that call for quiet sparkle, these natural diamond stud earrings bring a refined pear-shape motif to a classic close-to-ear silhouette. Round brilliant diamonds are arranged in a pave setting, creating a graceful glow that feels polished without being overpowering. Their petite shape, diamond shimmer, and easy styling make them a thoughtful gift for birthdays, anniversaries, graduations, work milestones, or a personal jewelry piece meant to be worn often.

1/2 CT Round Cut Natural Diamond Classic Stud Earrings For Women

These diamond stud earrings are crafted with 36 natural round diamonds weighing approximately 0.51 carat in total. The stones are finished with a brilliant cut and arranged in a pave setting to create continuous sparkle across the pear-inspired design. With HI color and SI quality grade, the earrings offer a bright diamond look in a compact stud style that remains easy to pair with everyday and occasion outfits.

What Makes This Special

The design combines the familiar comfort of stud earrings with a more expressive pear-shape motif. Instead of a single-stone look, the pave arrangement uses multiple round diamonds to create a fuller, softly tapered sparkle across each earring.

The pair measures approximately 10.5 mm in length, 5.5 mm in width, and 1.5 mm in height, with an approximate product weight of 1.28 gm. These proportions give the earrings noticeable shape while keeping the profile light and wearable.

The diamond layout includes round stones in multiple approximate sizes: 0.90 x 0.90 mm, 1.10 x 1.10 mm, 1.30 x 1.30 mm, 1.40 x 1.40 mm, 1.50 x 1.50 mm, 1.60 x 1.60 mm, and 1 x 1 mm. Available metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Why Choose This Design

The round brilliant cut helps each diamond catch light with crisp sparkle, while the pave setting creates a closely set diamond surface for a more luminous effect. This makes the earrings a strong choice for shoppers who want a petite diamond stud with more detail than a plain solitaire pair.

The pear-shape motif adds soft movement and a graceful outline, making the earrings flattering from the front while still remaining practical for daily styling. Their slim 1.5 mm height gives them a neat profile, and the metal choices allow the look to shift from cool and modern to warm and classic depending on the selected finish.

Design Meaning

The pear-inspired silhouette brings a sense of softness, growth, and graceful movement to the design. Paired with natural diamonds, the motif can feel especially meaningful as a gift that celebrates affection, achievement, or a fresh beginning. The cluster of round diamonds adds the feeling of many small moments coming together, making these studs a fitting keepsake for personal milestones and heartfelt occasions.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to diamond placement, pave setting security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase. Before dispatch, the earrings go through stone inspection, setting security review, and finishing inspection to help ensure the piece is ready for gifting or personal wear. To care for them, store separately, avoid harsh chemicals, and clean gently with a soft jewelry cloth after use.

Style and Wearability

These diamond studs sit close to the ear while offering a gently elongated shape that adds polish without feeling heavy. They work well with workwear, casual outfits, evening dresses, and layered jewelry looks. White metal options create a crisp diamond-forward finish, while yellow gold choices bring warmth to the pear-shaped outline. Their thoughtful sparkle makes them suitable for everyday wear, gifting, and special celebrations.

Product Information
SKU SHP-EARRINGS042210102
Length 10.5 mm
Width 5.5 mm
Height 1.5 mm
Weight 1.28 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-4 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.50X1.50 mm-4 Pcs
Round-1.60X1.60 mm-6 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings

FAQs About: 1/2 CT Round Cut Natural Diamond Classic Stud Earrings

What diamonds are used in these classic stud earrings?

These earrings are set with 36 natural round diamonds weighing approximately 0.51 carat in total. The diamonds have HI color and SI quality grade.

What cut and setting style do these diamond earrings have?

The diamonds are round in shape with a brilliant cut. They are arranged in a pave setting, giving the pear-shape motif a closely set, sparkling diamond surface.

What makes the pear-shape motif special?

The pear-shape motif gives the studs a graceful, softly tapered outline. It adds more visual interest than a plain round stud while keeping the design refined and easy to wear.

Which metal options are available for these diamond studs?

These earrings are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Are these earrings suitable for daily wear?

Yes, the stud silhouette and slim approximate 1.5 mm height make them suitable for regular wear. Their approximate 10.5 mm by 5.5 mm size gives them visible shape while keeping the profile comfortable and refined.

Do these natural diamond earrings come with a certificate?

Yes, Rosec Jewels offers a Certificate of Authenticity with the product. Each pair also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for these diamond stud earrings?

Store the earrings separately, keep them away from harsh chemicals, and wipe them gently with a soft jewelry cloth after wear. Remove them before swimming, exercising, or applying perfumes and lotions to help preserve their finish and sparkle.