Round Moissanite Heart Dangle Drop Earrings

Regular price £686.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Romantic Heart Drop Design

The Round Moissanite Heart Dangle Drop Earrings combine a timeless heart silhouette with the brilliance of round moissanite accents. Designed to move gently with the wearer, the drop format adds fluidity and visual interest.

This style is suited for those who prefer expressive yet refined earrings. The heart motif introduces a soft romantic element, while the dangle structure enhances light reflection through natural motion.

Dangle Structure & Setting

The drop construction allows the heart element to hang freely below the ear, creating subtle movement. This structure enhances visibility and sparkle without overwhelming the face.

Round moissanite stones are integrated to complement the heart form, supporting balanced brilliance and a cohesive silhouette.

Moissanite for Regular Wear

Moissanite is known for its durability and strong light performance. Its hardness makes it suitable for fine jewelry designed for both occasional and frequent wear.

Created without traditional mining, moissanite offers an alternative gemstone option, though environmental impact varies by production and energy source.

High-Level Features

These earrings feature a heart-inspired drop design accented with round moissanite. The combination of movement, symbolic shape, and brilliance makes them adaptable for celebrations, gifting, or everyday elegance.

Product Information
SKU SHP-EARRINGS052210072
Metal Weight 2.40 gm (Approximate)
Total Stone Weight 0.99 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 70 Pieces
Total Weight 0.99 Carat (Approximate)
Dimension(approx) Round-3X3 mm-4 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.10X1.10 mm-14 Pcs
Round-1X1 mm-16 Pcs
Round-0.90X0.90 mm-20 Pcs
Round-0.80X0.80 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Illusion-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
dangle-earrings

FAQs About: Round Moissanite Heart Dangle Drop Earrings

Do heart dangle earrings move while worn?
Yes, the drop design allows the heart element to move naturally, enhancing light reflection and adding visual interest.
Is moissanite suitable for special occasions?
Moissanite is valued for its brilliance and clarity, making it an attractive option for celebrations and formal events.
Are these earrings appropriate for gifting?
The heart motif and elegant drop style make them a thoughtful gift choice for anniversaries, birthdays, or meaningful milestones.
Can dangle earrings be worn comfortably for extended periods?
When designed with balanced proportions and secure closures, dangle earrings can be worn comfortably for extended wear.
How should I care for moissanite drop earrings?
Gentle cleaning with mild soap and water and periodic inspection of the settings help maintain brilliance and structural integrity.