Vintage Inspired Ethiopian Opal Flower Engagement Ring with Wedding Band

Regular price £1,392.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Distinctive Bridal Set with Vintage Character

The Vintage Inspired Ethiopian Opal Flower Engagement Ring with Wedding Band is designed for those who appreciate expressive detail and coordinated elegance. Created as a matching set, the engagement ring and wedding band complement one another, forming a cohesive bridal look from the moment you say yes.

This design appeals to brides seeking something romantic and less conventional than a traditional solitaire, while still maintaining balance and refinement.

Floral-Inspired Design with Coordinated Band

The flower motif centers the composition, bringing soft curves and dimensional detailing to the ring’s profile. The matching wedding band is shaped to sit harmoniously alongside the engagement ring, enhancing the overall silhouette rather than competing with it.

This intentional pairing allows both rings to be worn together comfortably, preserving visual symmetry and structural integrity.

Ethiopian Opal as the Focal Point

Ethiopian opal is admired for its shifting play of color and luminous appearance. Each stone can display unique flashes of light, making every ring subtly individual. Due to the natural characteristics of opal, mindful wear is recommended to help preserve its surface and finish over time.

Complete specifications regarding stone details, metal options, and measurements are provided in the product detail tables below.

High-Level Features

  • Vintage-inspired floral engagement ring with coordinating wedding band.
  • Ethiopian opal centerpiece with distinctive color play.
  • Designed as a cohesive bridal set for balanced wear.
  • Detailed technical specifications are listed in the product tables below.
Product Information
SKU SHP-RINGS032228326
Metal Weight 4.80 gm (Approximate)
Center Stone Weight 0.88 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.88 Carat (Approximate)
Dimension(approx) Cushion-6X6 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Cushion
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 42 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-30 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.60X1.60 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-rings

FAQs about: Vintage Inspired Ethiopian Opal Flower Engagement Ring with Wedding Band

Is this engagement ring sold as a complete set?
Yes, this design includes both the engagement ring and the coordinating wedding band, created to be worn together as a matched bridal set.
Is Ethiopian opal suitable for everyday wear?
Opal is softer than many traditional gemstones. While it can be worn regularly, removing the ring during strenuous activities and avoiding exposure to harsh chemicals can help maintain its condition.
Will the wedding band sit flush with the engagement ring?
The wedding band is designed to align with the engagement ring’s shape for a coordinated appearance. Exact fit details are reflected in the product specifications above.
Does each opal look the same?
Ethiopian opals are known for their natural variation in color play. Subtle differences in pattern and flash are normal and contribute to the individuality of each piece.
Where can I find the exact stone and metal details?
All verified details regarding metal type, gemstone characteristics, and measurements are available in the product detail tables above for accurate reference.