Baguette London Blue Topaz Art Deco Eternity Band with Diamond

Regular price £538.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Crafted with timeless sophistication and distinctive allure, this Vintage Wedding Band serves as a remarkable emblem of love and togetherness. It showcases baguette cut london blue topaz and round diamond stones arranged in an alternating sequence across the central row, producing a striking and visually appealing contrast. Diamonds are set in a circle style, enhancing the overall brilliance. Each detail, from the glimmering edges to the deep allure of the topaz, contributes a special element to this meticulously designed Half Eternity Band. It is ideal for individuals who value exquisite details, significant materials, and a touch of added sparkle. The blend of AAA quality london blue topaz and dazzling HI-SI quality diamonds results in a timeless aesthetic with a dash of drama, perfect for commemorating significant events. Made with precision and care, the London Blue Topaz Eternity Ring is tailored for a secure and comfortable fit. It is presented in an elegant package, making it a delightful option for a wedding gift or a cherished memento for oneself. Whether you are making a proposal, commemorating a significant occasion, or presenting it as a gift to a cherished individual, this Blue Topaz and Diamond Ring is designed to endure and be cherished for many years. It is presented in an exquisite jewelry box, prepared to astonish, please, and integrate into your narrative.

Product Information
SKU SHP-RINGS032222392
Metal Weight 2.08 gm (Approximate)
Total Stone Weight 1.16 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 4 Pieces
Total Weight 0.56 Carat (Approximate)
Dimension(approx) Baguette-2X4 mm-4 Pcs
Color Blue
Cut Brilliant
Shape Baguette
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-24 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-rings