Brilliant Cut Moissanite Flower Promise Ring with Certificate

Regular price £232.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Moissanite Flower Promise Ring

This promise ring features brilliant cut moissanite arranged in a floral-inspired design. The cluster of stones forms a flower-like shape that creates visual sparkle while maintaining a refined and elegant appearance.

Floral Ring Design

The flower motif places multiple stones in a structured pattern that resembles blooming petals. This design introduces decorative detail while keeping the ring balanced and symmetrical.

Brilliant Cut Moissanite

Brilliant cut gemstones are designed with facets that maximize light reflection. This cutting style enhances the sparkle of moissanite, allowing the stones to display noticeable brilliance.

Moissanite Gemstone

Moissanite is a gemstone known for its strong brilliance and durability in jewelry. Its optical properties allow it to reflect light effectively, giving it a bright and lively appearance.

Certified Promise Ring

The ring is offered with certification for the moissanite gemstone, providing documentation of the stone's characteristics. The floral design combined with brilliant cut stones creates a meaningful and decorative promise ring style.

Product Information
SKU SHP-RINGS092212383
Weight 2.87 gm (Approximate)
Center Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
solitaire-engagement-rings

FAQs About: Brilliant Cut Moissanite Flower Promise Ring with Certificate

What is moissanite?
Moissanite is a gemstone known for its strong brilliance and optical sparkle. It is commonly used in jewelry as a durable and visually bright gemstone.
What is a brilliant cut gemstone?
A brilliant cut gemstone features multiple facets arranged to reflect light effectively. This cutting style is designed to maximize sparkle and brightness.
What does a flower ring design mean?
A flower ring design arranges gemstones to resemble petals around a center, creating a decorative floral pattern that adds visual detail to the ring.
What is a promise ring?
A promise ring symbolizes commitment between partners and is often exchanged as a meaningful gesture of dedication.
How should a moissanite ring be cleaned?
Clean the ring with warm water, mild soap, and a soft cloth or brush. Rinse thoroughly and dry gently to maintain the gemstone’s sparkle.