Certified 1.5 Carat Lab Grown Ruby Flower Engagement Ring with Diamond

0
Regular price £1,151.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Captivating in every detail, this Flower Engagement Ring is a stunning symbol of love that blossoms with elegance. At its center sits a 6X8mm Oval Shape Lab Created Ruby, radiating deep red tones that represent devotion, courage and a love that grows stronger with time. Surrounding the Lab Ruby, a Halo of sparkling Diamond stones and petals, creating a flower motif that celebrates romance, new beginnings and the natural beauty of a flourishing relationship. The oval center stone elongates the finger, while the Diamond Halo adds a radiant sparkle that complements both classic and contemporary styles. The flower design carries profound symbolism, representing growth, harmony and the blossoming journey of love shared between two people. Presented in a signature jewelry box and available in a variety of ring sizes, this Lab Ruby Engagement Ring for Women is a thoughtful and meaningful expression of eternal love. This Lab Ruby Diamond Engagement Ring is a piece designed to be treasured for a lifetime, capturing both beauty and the promise of a bond that continues to bloom with each passing day.

Product Information
SKU SHP-RINGS032221174
Metal Weight 4.30 gm (Approximate)
Center Stone Weight 1.55 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 1.55 Carat (Approximate)
Dimension(approx) Oval-6X8 mm-1 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stone-shape-swatches