Certified Moissanite Promise Ring with Butterfly Motif

0
Regular price £702.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Round Cut Moissanite Ring is made to celebrate true love and meaningful promises. At the center is a 5 MM round moissanite, set in secure prong setting that lets it shine bright from every angle. The band has a split shank design, showing two paths coming together as one, just like your journey together. On one side of the band, there is a lovely butterfly motif, created with marquise and round moissanite stones. This small detail adds a special touch, perfect for marking new beginnings, whether it' is a promise, a surprise proposal, or simply a way to show your love. This Moissanite Promise Ring for Her blends simple beauty with deep meaning. It is light, easy to wear every day, and full of emotion. Whether you are celebrating an anniversary, a milestone, or making a personal vow, this Butterfly Ring speaks from the heart without needing many words. Carefully made for comfort and sparkle, it brings a soft glow to the finger without being too flashy. It comes in a lovely gift box and includes a gemstone certificate, making it ready for gifting or keeping as a special memory. This Split Shank Ring is a sweet and timeless way to say your love will always grow, change, and stay strong, just like a butterfly in flight.

Product Information
SKU SHP-RINGS082214367
Width 5 mm
Height 3.5 mm
Metal Weight 2.00 gm (Approximate)
Center Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 5 Pieces
Total Weight 0.79 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-2 Pcs
Round-2X2 mm-2 Pcs
Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings