Certified Moissanite Snowflake Necklace for Women

Regular price £291.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture the magic of winter beauty with this Snowflake Pendant Necklace, designed to add a soft sparkle to your everyday style. Inspired by the uniqueness of snowflakes, this pendant features an intricate motif fully adorned with shimmering Moissanite stones that reflect light from every angle. The design feels graceful and full of charm, perfect for those who love subtle yet eye-catching jewelry. It sits beautifully on the neckline, making it easy to pair with both casual outfits and dressy looks without feeling too heavy or flashy. Whether you are heading out for an evening, a festive celebration or simply want to add a hint of shine to your day, this Moissanite Pendant Necklace fits effortlessly into every moment. Its timeless design makes it a piece you will keep reaching for, season after season. Carefully packed in a signature jewelry box, this Moissanite Necklace for Women also makes a thoughtful gift for birthdays or holidays. Simple, elegant, and quietly dazzling, this Snowflake Necklace is all about celebrating your unique sparkle.

Product Information
SKU SHP-PENDANT032213957
Length 22 mm
Width 18.2 mm
Metal Weight 5.50 gm (Approximate)
Total Stone Weight 1.13 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 6 Pieces
Total Weight 1.13 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-6 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type 2-Prong-setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces