Certified Real Diamond Teardrop Earrings with Screw Back

Regular price £254.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Dazzle up any moment with these exquisite Diamond Teardrop Earrings, designed to bring elegance and sparkle to every occasion. The graceful Teardrop motif, adorned with delicate Diamond stones, hangs beautifully from a Diamond studded eye-catching design, creating a stunning play of movement and light. Featuring a secure Screw Back Closure, these Diamond Drop Earrings are comfortable for all-day wear, allowing you to shine with confidence without worry. Perfect for dressing up a chic evening outfit, adding sparkle to your work attire or complementing your wedding ensemble, these Diamond Earrings for Women are versatile, timeless and unforgettable. They also make an ideal gift for someone you cherish, coming beautifully packaged in a jewelry box ready to delight from the very first glance. The delicate yet striking design balances modern style with classic charm, ensuring these earrings remain a treasured piece in any collection.

Product Information
SKU SHP-EARRINGS082210198
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.28 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 56 Pieces
Total Weight 0.28 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-28 Pcs
Round-0.90X0.90 mm-16 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1X1 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings