Created Black Diamond Heart Engagement Ring Set with Diamond

Regular price £631.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Heart Shape Black Diamond Ring Set

This engagement ring set features a heart shape created black diamond as the center stone, giving the design a romantic silhouette with a bold and modern tone. The dark center stone creates strong visual contrast, making the ring set especially distinctive for buyers who want a bridal style beyond traditional white gemstone looks.

The heart motif adds emotional significance to the design, making it well suited for someone looking for a ring set that feels symbolic as well as visually striking.

Coordinated Bridal Set Design

As a ring set, this design pairs the engagement ring with a matching band that complements the center ring visually. This coordinated structure creates a more complete bridal look and helps the pieces feel intentional when worn together.

Matching sets are often chosen by buyers who want a balanced design from the beginning, rather than pairing separate rings later.

Created Black Diamond with Diamond Contrast

The created black diamond gives the design its dramatic focal point, while round diamonds add brightness and definition around the ring set. This contrast between dark and light stones helps the center stone stand out while bringing extra brilliance to the overall design.

Because the center stone is created without traditional mining, it may appeal to buyers considering alternative gemstone options. As with any production method, impact varies by production and energy source.

Distinctive Yet Refined Bridal Style

The overall design combines romantic symbolism, gemstone contrast, and a coordinated bridal structure. Together, these elements create a ring set that feels expressive, polished, and memorable.

It is especially suited to someone who wants a wedding ring set with a clear point of difference while still keeping a refined jewelry finish.

Product Information
SKU SHP-RINGS032228999
Weight 3.84 gm (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA (Synthetic)
DIAMOND INFORMATION
No.of Stones 60 Pieces
Total Weight 0.77 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-15 Pcs
Round-1.20X1.20 mm-23 Pcs
Round-1.30X1.30 mm-10 Pcs
Round-1.40X1.40 mm-10 Pcs
Round-1X1 mm-1 Pcs
Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI

View More

Product Parent Collection Handle
black-diamond-women-wedding-bands

Frequently Asked Questions

What is included in an engagement ring set?
An engagement ring set typically includes the engagement ring and a coordinating matching band designed to be worn together.
Why is a heart shape ring chosen for engagement jewelry?
Heart shape rings are often chosen for their romantic symbolism and distinctive silhouette, making them a meaningful option for engagement jewelry.
What is a created black diamond?
A created black diamond is formed in controlled conditions rather than through traditional mining and is valued for its bold dark appearance.
Why are white diamonds paired with black diamonds?
White diamonds are often paired with black diamonds to add brightness and contrast, helping define the center stone and enhance the design.
Can a bridal ring set be worn every day?
Bridal ring sets are commonly chosen for everyday wear because the coordinated design keeps the rings visually balanced when worn together.