Cushion Cut Solitaire Zircon Gold Floral Engagement Ring

0
Regular price £1,164.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Cushion Cut Zircon Engagement Ring

The Cushion Cut Solitaire Zircon Gold Floral Engagement Ring presents a refined design that highlights the brilliance of a cushion cut zircon center stone. Its softly rounded square shape creates a balanced and elegant focal point, offering a gemstone engagement ring that feels both timeless and distinctive.

Floral Inspired Ring Design

The floral inspired setting introduces delicate design elements that resemble natural petals and organic forms. These subtle details frame the center gemstone while adding character and visual depth to the ring. The floral motif contributes to a graceful aesthetic that blends classic jewelry craftsmanship with nature inspired styling.

Zircon Center Stone

Zircon is valued for its bright brilliance and gemstone clarity. The cushion cut enhances the stone’s sparkle by combining a soft square outline with rounded corners that allow light to reflect across the gemstone’s facets. This cut complements the floral design while maintaining a refined solitaire presentation.

A Nature Inspired Engagement Ring

This ring combines the elegance of a solitaire gemstone with floral design inspiration. The cushion cut zircon stands at the center of a carefully balanced structure, creating an engagement ring that highlights gemstone brilliance while expressing a gentle, nature inspired style.

Product Information
SKU SHP-RINGS082220045
Width 6.5 mm
Height 8 mm
Weight 3.60 gm (Approximate)
ZIRCON INFORMATION
No.of Stones 9 Pieces
Total Weight 2.18 Carat (Approximate)
Dimension(approx) Cushion-7X7 mm-1 Pcs
Round-1.30X1.30 mm-8 Pcs
Color White
Cut Brilliant
Shape Cushion, Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
cubic-zirconia-rings

FAQs About: Cushion Cut Solitaire Zircon Gold Floral Engagement Ring