Cute Moissanite Fish Earrings with Screw Back

Regular price £222.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch of playful sparkle to your jewelry collection with these Fish Earrings, designed to bring charm and personality to your everyday style. Inspired by the graceful shape of a Fish, these Fine Earrings feature a beautifully detailed motif that feels both fun and elegant. The Fish is adorned with petite Moissanite stones that shimmer gently, creating a bright and lively sparkle. Handcrafted with a secure Screw Back Closure, these Moissanite Earrings offer a comfortable fit and stay firmly in place throughout the day, making them ideal for daily wear. Whether you are heading out for a casual day or dressing up for a small celebration, these Moissanite Diamond Earrings effortlessly complement casual outfits. Their cute and cheerful design also makes them a thoughtful gift for someone who loves distinctive and meaningful jewelry. Perfect for birthdays or just as a sweet surprise, these Moissanite Ear Studs are sure to bring a smile. These Fish Earrings for Women are a delightful blend of sparkle, style and charm.

Product Information
SKU SHP-EARRINGS072210059
Length 8.2 mm
Width 10.5 mm
Height 1.6 mm
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 0.63 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 52 Pieces
Total Weight 0.63 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-10 Pcs
Round-1.20X1.20 mm-26 Pcs
Round-1.30X1.30 mm-6 Pcs
Round-1.40X1.40 mm-2 Pcs
Round-1X1 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
stud-earrings