Heart Shaped Openwork Diamond Necklace

Regular price £250.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Affection in Refined Form

The Heart Shaped Openwork Diamond Necklace is designed for those who appreciate meaningful jewelry with a light, graceful presence. Its heart silhouette expresses sentiment without appearing heavy, making it suitable for everyday wear as well as special occasions. Whether chosen as a gift or a personal keepsake, it offers a balanced blend of symbolism and understated brilliance.

Openwork Design with Structured Setting

The openwork construction creates visual depth while allowing light to pass through the design, enhancing the sparkle of the diamonds. This thoughtful structure reduces visual weight, helping the pendant sit comfortably against the neckline. The gold framework outlines the heart shape clearly, ensuring durability while maintaining a delicate aesthetic.

Diamond Value and Everyday Suitability

Diamonds are selected for their clarity and ability to reflect light consistently, making them well-suited for daily wear when cared for properly. Their durability supports long-term use, allowing this necklace to remain a lasting part of a jewelry collection. As with all fine jewelry, periodic cleaning and mindful storage help preserve its finish and brilliance over time.

High-Level Features

  • Heart-shaped openwork pendant with diamond detailing.
  • Crafted in gold for strength and refined contrast.
  • Lightweight silhouette designed for comfortable wear.
  • Complete specifications, dimensions, and metal details are provided in the product tables above.
Product Information
SKU SHP-PENDANT121911454
Length 17.5 mm
Width 17.5 mm
Height 6.8 mm
Metal Weight 4.20 gm (Approximate)
Total Stone Weight 0.29 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-2X2 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces

FAQs About: Heart Shaped Openwork Diamond Necklace

Is this necklace suitable for everyday wear?
Yes, the openwork design and durable materials make it suitable for regular wear with proper care and storage.
Does the pendant feel heavy on the neck?
The openwork structure is designed to reduce visual and physical weight. For exact measurements and weight details, please refer to the product specification tables above.
Is this necklace a good gift option?
The heart motif makes it a meaningful choice for anniversaries, birthdays, or personal milestones, offering both symbolism and refined style.
Are the diamonds suitable for long-term use?
Diamonds are known for their durability and light performance, making them suitable for long-term wear when properly maintained.
Where can I find full product specifications?
Detailed information about dimensions, metal options, and other specifications is available in the product detail tables above.