Natural Aquamarine Heart Drop Earrings with Diamond

0
Regular price £828.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Representing everlasting love and devotion, these Heart Drop Earrings are a perfect blend of elegance, romance and sparkle. Each earring features a delicate Heart motif, from which dangles an Open Heart frame lined with shimmering Diamond stones, featuring a 4 mm Aquamarine at its center. The soft blue of the Aquamarine evokes serenity and devotion, while the Diamond stones catch the light with every movement, creating a captivating sparkle that draws the eye and stirs the heart. Secured with Screw Back Closure, these Aquamarine Diamond Earrings offer comfort and confidence for all-day wear, whether paired with a romantic evening gown or a chic daytime outfit. The graceful heart design symbolizes affection, commitment and the beauty of heartfelt connections, making them an ideal gift for a loved one or a treasured addition to your own jewelry collection. Presented in a signature jewelry box, these Aquamarine Drop Earrings are ready to delight and impress, transforming any moment into something truly special.

Product Information
SKU SHP-EARRINGS052174746
Length 17 mm
Width 9.4 mm
Metal Weight 2.11 gm (Approximate)
Total Stone Weight 0.68 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 30 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-2 Pcs
Round-1X1 mm-28 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-earrings