Natural Diamond Flower Promise Ring

Regular price £396.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Express your blooming love with a ring that feels as heartfelt and beautiful as your promise. This Flower Promise Ring is designed to capture romance, blending soft symbolism with delicate sparkle. Each petal of the flower is shaped like a tiny heart, coming together to represent love, care and the bond you share. Adorned with dainty Diamond stones, the floral design glimmers gently, creating a look that is sweet, elegant and full of meaning. The flower motif symbolizes growth and new beginnings, making this Diamond Flower Ring a meaningful choice for a promise, anniversary or a simple reminder of forever. Its romantic design pairs beautifully with everyday outfits or special occasions, adding a soft sparkle that never feels overdone. Available in various ring sizes, this Commitment Ring is crafted for comfort. It arrives ready to gift in a signature jewelry box, making your moment even more special. This Pinky Promise Ring is a timeless expression of devotion, affection and a love that continues to blossom with every passing day.

Product Information
SKU SHP-RINGS022210187
Width 8 mm
Height 2 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.38 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 15 Pieces
Total Weight 0.38 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-15 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
flower-jewelry