Nature Inspired 0.6 Carat Lab Grown Blue Sapphire Engagement Ring with Diamond

Regular price £426.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the elegance of nature, this Nature Inspired Engagement Ring captures the essence of timeless romance. At its center lies a 5 mm Round Shape Lab Created Blue Sapphire set in Claw Setting, its deep hue evoking calm, devotion and sincerity. Encircling the center stone, a Halo of sparkling Diamond stones forms a floral motif, creating the impression of a blossoming flower that catches the light from every angle. On either side, two Marquise Shape Diamond stones accentuate the design, gracefully extending along the split shank to add a touch of sophistication. When worn, the Lab Grown Blue Sapphire Engagement Ring commands attention with its elegant shimmer, making this Halo Engagement Ring a perfect companion for both everyday wear and special occasions. AAAA Quality Lab Grown Blue Sapphire stone mirrors the beauty of natural Blue Sapphire but is crafted sustainably, offering the same brilliance with an ethical touch. Symbolically, this Lab Grown Blue Sapphire Diamond Ring celebrates enduring love, loyalty and devotion, making it a profound choice for expressing lifelong commitment. Available in a variety of ring sizes, it comes complete with a signature jewelry box, ready to mark a memorable moment. Its combination of nature-inspired artistry, radiant stones and thoughtful craftsmanship makes this Lab Grown Blue Sapphire Ring for Women a symbol of deep connection and everlasting love, designed to be cherished for generations.

Product Information
SKU SHP-RINGS082216791
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-blue-sapphire-engagement-rings