Nature Inspired 1.3 Carat Lab Grown Ruby Engagement Ring with Diamond Trio

Regular price £647.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, this Flower Engagement Ring brings romance and elegance together in a design that blooms with meaning. At its center rests a 6mm Round Shape Lab Created Ruby set in Prong Setting, glowing in rich red tones that symbolize passion, devotion and enduring love. The Lab Grown Ruby is set within a graceful flower motif, representing growth, new beginnings and the blossoming of a relationship. On either side, a Trio of Round Shape Diamond stones adds sparkle and balance, enhancing the vibrant center stone while evoking the harmony found in patterns of nature. On the finger, this Lab Grown Ruby Engagement Ring captures attention with a subtle presence, its floral design creating a soft silhouette that flatters the hand while adding a touch of whimsy. The combination of AAAA Quality Lab Ruby and HI-SI Quality Diamond trio enhances both elegance and brilliance, making this Nature Inspired Engagement Ring perfect for everyday wear or special moments that mark a lifetime of love. Presented in a signature jewelry box and available in a variety of ring sizes, this Lab Grown Ruby Diamond Ring is a thoughtful, romantic expression of eternal love, designed to celebrate a journey that blooms endlessly with beauty and devotion.

Product Information
SKU SHP-RINGS032220847
Metal Weight 3.30 gm (Approximate)
Center Stone Weight 1.37 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 1.37 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.64 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-4 Pcs
Round-3X3 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-rings