Pear Cut London Blue Topaz Bridal Drop Earrings with Diamond Halo

Regular price £475.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These elegantly designed drop earrings highlight a pear shape London Blue Topaz enclosed in a sparkly halo of Diamond for an unmatched aura. A round Diamond on the top accentuates the shimmering pear motif and completes its exquisite look. For a playful touch, the base of the teardrop earring pair features a shiny heart motif. The pair comes with screw back closures that make them a comfortable option.

Product Information
SKU SHP-EARRINGS062190049
Length 13.5 mm
Width 6 mm
Metal Weight 2.70 gm (Approximate)
Total Stone Weight 2.06 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 2 Pieces
Total Weight 1.58 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 40 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-38 Pcs
Round-2X2 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-earrings