Solitaire 1 Carat Cubic Zirconia Vintage Looking Engagement Ring

0
Regular price £796.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make a statement with a ring that reflects the uniqueness of your love story. Tailored for the woman who embraces individuality, this Cubic Zirconia Engagement Ring combines striking beauty with exquisite craftsmanship. Features a stunning 7 MM round cut zircon, rated AAAA quality. Securely held in a prong setting, the center stone radiates brilliantly, capturing light from every direction. Just beneath the main stone, round zircon is hidden as a delightful surprise, adding a soft sparkle from a unique angle. What sets this Solitaire Engagement Ring apart is its designer ivy scroll band. Meticulously handcrafted, the band showcases lovely ivy-inspired designs with small zircon stones that gracefully flow along the shank. The blend of intricate details and premium stones gives the Ivy Engagement Ring a distinctive charm. The ivy scroll motif introduces a vintage inspired design, while the radiant zirconia stones add that extra brilliance. Designed to stand out and built to endure, this CZ Vintage Engagement Ring is the perfect choice for someone who dares to be unique and loves to shine in their own special way.

Product Information
SKU SHP-RINGS032218504
Width 5.4 mm
Height 7.9 mm
Metal Weight 2.49 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
ZIRCON INFORMATION
No.of Stones 51 Pieces
Total Weight 1.68 Carat (Approximate)
Dimension(approx) Round-1X1 mm-48 Pcs
Round-2X2 mm-2 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
cubic-zirconia-engagement-rings