Vintage Inspired 1.4 Carat Amethyst Emerald Cut Engagement Ring with Diamond

Regular price £368.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Captivating yet timeless, this Vintage Inspired Engagement Ring is designed for those who adore romance with a touch of old-world elegance. At the center of this exquisite fine ring rests a stunning 6X8 mm Emerald Cut Amethyst, glowing with rich purple tones that symbolize devotion, wisdom, peace and a deep emotional bond. Surrounding the center stone is an intricate flower motif adorned with sparkling Diamond accents, creating a graceful vintage inspired design that celebrates beauty, growth and everlasting love. The elegant emerald cut gives the ring a refined and sophisticated character, making this Amethyst Engagement Ring both eye-catching and meaningful. Inspired by antique charm yet styled for modern romance, this Amethyst Diamond Ring is perfect as an engagement ring, anniversary gift, promise ring, birthday surprise or a heartfelt expression of love. Beautifully presented in a signature jewelry box and available in multiple ring sizes, this enchanting Amethyst Ring for Women is a stunning way to celebrate forever and express eternal love with classic sophistication.

Product Information
SKU SHP-RINGS032229142
Metal Weight 2.20 gm (Approximate)
Center Stone Weight 1.40 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 1.40 Carat (Approximate)
Dimension(approx) Emerald Cut-6X8 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Emerald Cut
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-2X2 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-rings