Zircon Star Celestial Hoop Earrings

0
Regular price £1,201.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Celestial-Inspired Elegance for Everyday Wear

The Zircon Star Celestial Hoop Earrings bring a subtle cosmic influence into a wearable, refined form. Designed for those who appreciate light, expressive details, these earrings offer a balance between modern styling and delicate symbolism.

Their lightweight structure and understated sparkle make them suitable for both everyday use and thoughtful styling.

Star Motif with Hoop Structure

The star design introduces a celestial element that adds character without overwhelming the overall form. Combined with the hoop silhouette, it creates a fluid design that moves naturally with the wearer.

This pairing ensures the earrings feel both distinctive and easy to incorporate into different looks.

Zircon for Subtle Brilliance

Zircon is selected for its ability to reflect light, offering a bright and clean appearance. It provides a balanced level of sparkle that complements the design without appearing excessive.

This makes it a practical choice for those who prefer refined shine in their everyday jewelry.

High-Level Features Buyers Appreciate

The hoop design ensures secure and comfortable wear, while the celestial detailing adds visual interest. These earrings can be worn alone or layered with other pieces for a curated ear look.

Their versatile design allows them to transition easily between casual and occasion-based styling.

Product Information
SKU SHP-EARRINGS012011903
Length 16.5 mm
Width 7.5 mm
Weight 4.68 gm (Approximate)
ZIRCON INFORMATION
No.of Stones 48 Pieces
Total Weight 1.74 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-40 Pcs
Round-2X2 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
cubic-zirconia-earrings

FAQs About: Zircon Star Celestial Hoop Earrings

Are these earrings suitable for daily wear?
Yes, their lightweight and secure hoop design makes them suitable for regular wear.
What does the celestial star design represent?
The star motif is often associated with guidance, inspiration, and individuality in jewelry design.
Are hoop earrings comfortable for long wear?
Hoop earrings are designed to be lightweight and balanced, making them comfortable for extended use.
Can these earrings be styled with other jewelry?
Yes, their simple yet distinctive design allows them to pair well with other earrings or accessories.
Is zircon a good choice for earrings?
Zircon offers a bright appearance and works well for earrings intended for regular use with proper care.
Who are these earrings best suited for?
They are ideal for those who prefer symbolic, celestial-inspired designs with a modern and wearable form.