6 MM Lab Grown Diamond Nature Inspired Engagement Ring

Regular price £352.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

A love story drawn from nature, this lab grown diamond engagement ring brings together a luminous round center stone and a leaf-inspired band that feels personal, graceful, and full of meaning. At the center rests a 6 MM round brilliant lab grown diamond in EF-VS quality, secured in a 6-claw prong setting for a lifted, light-catching look. The band is shaped with delicate leaf detailing, giving the ring a floral-inspired character that feels thoughtful for a proposal, anniversary, birthday, Valentine’s Day, or any moment meant to be remembered.

Certified Lab Grown Diamond Nature Inspired Engagement Ring For Women

This nature-inspired proposal ring is designed around a white round brilliant lab grown diamond, complemented by two smaller round diamonds nestled into the leaf accents on either side. The three-stone layout adds symmetry and soft sparkle without taking attention away from the 6 MM center diamond. Available in 92.5 sterling silver as well as 10K, 14K, and 18K white or yellow gold, the design can be chosen in a metal tone that best matches her style.

What Makes This Special

The ring centers on a 6 MM round lab grown diamond with EF-VS quality and a brilliant cut that gives the design its bright, crisp sparkle. A 6-claw prong setting holds the center stone securely while allowing light to move through the diamond from multiple angles.

Two additional round diamonds, each approximately 2.10 MM, sit within the leaf details on either side of the center stone. Together, the three lab grown diamonds create an approximate total diamond weight of 1.07 carat. The leaf-inspired band brings sculptural detail to the ring, giving it a more expressive look than a plain solitaire while still keeping the center diamond as the focus.

Why Choose This Design

A round brilliant diamond is loved for its balanced shape and lively sparkle, making it a meaningful choice for an engagement ring that feels classic in structure yet personal in detail. The 6-claw prong setting gives the center diamond a secure hold and a defined outline, while the leaf accents soften the profile with nature-inspired movement.

This design is ideal for someone who wants a solitaire-style ring with extra character. The accent diamonds add brightness along the band, and the floral motif brings a romantic, organic feel without making the ring look overly ornate. With multiple metal choices, the same design can feel cool and sleek in white metal or warm and expressive in yellow gold.

Design Meaning

The leaf-inspired band gives this lab diamond engagement ring a tender message of growth, renewal, and a love that continues to flourish. Its floral influence makes it especially fitting for a proposal rooted in personal meaning, a promise for the future, or a celebration of a bond that has grown stronger with time. The center diamond represents the heart of the commitment, while the side diamonds add a quiet sense of balance and togetherness.

Authenticity & Craftsmanship

Rosec Jewels crafts this lab grown diamond engagement ring with close attention to stone placement, setting security, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure that the diamonds are properly set and the ring is ready for a meaningful moment. A Certificate of Authenticity is offered with the diamond ring for added confidence, and care guidance is available to help preserve the ring’s sparkle and finish over time.

Style and Wearability

The raised round center diamond gives the ring a graceful face-up presence, while the leaf-detailed band adds visual interest from the side and across the finger. It pairs naturally with romantic, floral, and minimal jewelry styles, making it suitable for a heartfelt proposal as well as everyday wear after the occasion. Choose sterling silver for a bright, accessible finish, white gold for a clean diamond-forward look, or yellow gold for a warmer expression of the nature-inspired design.

Product Information
SKU SHP-RINGS022510008
Weight 3.76 gm (Approximate)
Center Stone Weight 1.07 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 1.07 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-2 Pcs
Round-6X6 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 6-Claw-Prong-Setting
Quality Grade EF-VS
View More

FAQs About: 6 MM Lab Grown Diamond Nature Inspired Engagement Ring

What makes this ring suitable for a proposal?

This ring combines a 6 MM round brilliant lab grown diamond with a leaf-inspired band, giving it both proposal-worthy sparkle and personal symbolism. The center diamond creates a strong focal point, while the nature-inspired details make the design feel meaningful for a commitment, anniversary, or romantic milestone.

What does the leaf-inspired design symbolize?

The leaf motif symbolizes growth, renewal, and a love that continues to flourish. It gives the engagement ring a softer, more personal identity than a plain solitaire, making it a thoughtful choice for someone who connects with nature-inspired jewelry and romantic detail.

What stone cut and setting are used in this engagement ring?

The ring features round brilliant lab grown diamonds. The 6 MM center diamond is secured in a 6-claw prong setting, a style that helps hold the stone firmly while giving the diamond an open, light-catching appearance.

Does this ring include accent diamonds?

Yes. In addition to the 6 MM round center diamond, the ring includes two smaller round lab grown diamonds placed within the leaf details on either side. The design has 3 diamonds in total with an approximate total weight of 1.07 carat.

What metal options are available for this ring?

This engagement ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These choices allow the same nature-inspired design to be styled in either a cool white tone or a warmer yellow tone.

Does this lab grown diamond ring come with authenticity support?

Rosec Jewels offers a Certificate of Authenticity with the jewelry. The ring also goes through stone inspection, setting security review, and finishing inspection before dispatch to support product confidence.

How should I care for this nature-inspired diamond ring?

Clean the ring gently with mild soap, warm water, and a soft brush, then dry it with a lint-free cloth. Store it separately from other jewelry to help protect the diamonds and metal finish, and avoid harsh chemicals or heavy impact during wear.