Certified Cubic Zirconia Key Pendant Necklace with Paw Motif

Regular price £234.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This unique Key Necklace perfectly showcases the special bond between you and your furry friend. The Cubic Zirconia Pendant features a beautifully crafted key with a round top and an open paw print. The circular frame around the paw print is adorned with sparkling cubic zirconia. You could team this Paw Print Necklace up on the days you wish to express your love for your furry companions or any day you feel like making an extra cute statement. This sophisticated locket with key Necklace embodies the beauty of cute things and is a perfect expression of your affection. You can have confidence in the quality of our offerings, as each piece is accompanied by a certificate of authenticity.

Product Information
SKU SHP-PENDANT032213548
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.35 Carat (Approximate)
ZIRCON INFORMATION
No.of Stones 33 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-33 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
key-necklaces