Certified Diamond Flower Helix Drop Earring

Regular price £386.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your fashion game with our Diamond Flower Earring, a true emblem of elegance and individuality. This diamond drop earring is made from high-quality metal and features delicate round diamonds that add extra sparkle, complemented by a charming metal floral design that dangles gracefully. Perfect for Tragus, Cartilage, or Helix piercings, this Flower Drop Earring brings a touch of sophisticated beauty to any outfit. The floral motif makes it an ideal accessory for any event. Gift this Helix Piercing Earring to your loved one and witness her priceless reaction! Whether as a birthday present, an anniversary gift, or a romantic surprise, it beautifully commemorates lifes most treasured moments. It comes in a variety of metal color options and is available in different metal selections. This Piercing Stud includes a certificate of authenticity for the gemstones and is presented in a luxurious storage box.

Product Information
SKU SHP-BODYJ082410088
Metal Weight 1.00 gm (Approximate)
Total Stone Weight 0.20 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 11 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-5 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.70X1.70 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More