Certified Zircon Angle and Devil Twin Heart Necklace

Regular price £234.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This stunning Cubic Zirconia Pendant perfectly represents love in all its forms - pure, playful, and passionate. The design features two intertwined open hearts, delicately encrusted with sparkling AAAA Quality zircon stones in surface prong setting. One heart features a polished oval motif at the top, signifying the angelic purity of love while the other has small devil horns and a curved tail, adding a fun and bold touch. Whether you are showing your love for someone special or treating yourself, this Open Heart Necklace is a perfect choice. It reminds us that love can be both gentle and exciting, making it a unique and thoughtful gift for any occasion.

Product Information
SKU SHP-PENDANT032213525
Metal Weight 3.90 gm (Approximate)
Total Stone Weight 0.57 Carat (Approximate)
ZIRCON INFORMATION
No.of Stones 53 Pieces
Total Weight 0.57 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-49 Pcs
Round-1.20X1.20 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
heart-necklaces