Diamond Heart Cartilage Earring

Regular price £330.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Small in size yet full of feeling, this diamond heart cartilage earring brings a romantic sparkle to a curated ear. The heart silhouette is set with round diamonds, creating a delicate symbol of love, affection, and personal expression. Sold singly, it is perfect for styling one piercing with intention, gifting a sweet reminder of care, or adding a meaningful diamond accent to helix, cartilage, tragus, conch, or upper lobe jewelry.

Heart Shaped Cartilage Earring with Diamonds

This heart cartilage earring is crafted with 9 round diamonds in a prong setting, creating an approximate total diamond weight of 0.12 carat. Each diamond measures approximately 1.20 x 1.20 mm, adding refined sparkle across the heart-shaped design. With lab diamond EF-VS and natural diamond HI-SI quality options, flat back post length selections, and multiple gold choices, it is designed for comfortable 24/7-inspired wear in a modern piercing stack.

What Makes This Special

The earring features 9 round diamonds with an approximate total weight of 0.12 carat. Each diamond measures approximately 1.20 x 1.20 mm, creating a bright, delicate surface of sparkle across the heart motif.

The diamonds are round in shape, brilliant cut, HI color, SI quality grade, and secured in prong settings. The heart shape gives the earring a soft romantic identity, while the compact flat back design makes it suitable for helix, cartilage, tragus, conch, and upper lobe piercings.

The earring has an approximate metal weight of 0.70 gm and is sold singly. Metal options include 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, with left ear and right ear selections available.

Why Choose This Design

A heart-shaped earring brings emotional meaning to a piercing stack, making it more personal than a simple diamond stud. The round diamonds add light across the motif without making the design feel oversized, so the piece remains easy to wear while still carrying visible sparkle.

The prong setting keeps the diamonds open to light and helps define the heart outline. The flat back closure supports a smooth fit, reducing pokes and making the earring practical for daily routines, travel, workouts, and comfortable rest.

Design Meaning

The heart design is a direct symbol of love, care, devotion, and emotional connection. In this cartilage earring, the motif becomes a small but meaningful reminder of affection, whether chosen as a romantic gift, friendship token, self-love piece, or personal celebration. Its diamond sparkle adds a lasting touch to a sentiment that feels close and easy to carry every day.

Authenticity & Craftsmanship

Each earring is carefully crafted with attention to diamond placement, prong setting security, heart-shaped detail, smooth flat back finishing, and comfortable proportions. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for styling or gifting. For lasting care, store it separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This diamond heart earring adds a soft romantic accent to helix, cartilage, tragus, conch, and upper lobe piercings. Worn alone, it creates a sweet focal point; paired with tiny diamond studs, gold hoops, flat backs, or other heart jewelry, it helps build a curated ear with warmth and personality. Its single-piece format makes asymmetric styling easy, while the gold options allow it to blend naturally with warm or cool jewelry stacks.

Product Information
SKU SHP-BODYJ012410028
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-9 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Heart Cartilage Earring

What makes this diamond heart cartilage earring a meaningful gift?

The heart shape symbolizes love, affection, and emotional connection, while the diamond accents add refined sparkle. This makes the earring a thoughtful gift for birthdays, Valentine’s Day, anniversaries, friendship moments, or a self-love jewelry piece.

How many diamonds are used in this heart earring?

The earring includes 9 round diamonds with an approximate total weight of 0.12 carat. Each diamond measures approximately 1.20 x 1.20 mm.

What cut, color, and quality are listed for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are listed as HI color and SI quality grade, with gemstone quality options available in lab diamond EF-VS and natural diamond HI-SI.

Which piercings can this earring be worn in?

This diamond heart earring is designed for multiple piercing placements, including helix, cartilage, tragus, conch, and upper lobe piercings.

Is this earring sold as a single piece or a pair?

This earring is sold singly. Left ear and right ear selections are available, making it easy to style one piercing or create an asymmetric curated ear look.

What metal and post length options are available?

The earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm.

How should I care for this diamond heart cartilage earring?

Store the earring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry it carefully before storing.