Diamond Pin Earring for Helix Piercing

Regular price £344.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Minimal Pin Design for Helix Styling

The Diamond Pin Earring for Helix Piercing offers a sleek, linear silhouette tailored for upper-ear placements. Its pin-inspired form delivers a modern edge while maintaining a refined, minimal presence.

This design is ideal for curated ear looks where proportion and alignment matter. The streamlined shape complements other studs and hoops without overpowering them.

Helix-Specific Structure & Setting

Created for helix wear, the structure is scaled to sit comfortably along the ear’s outer rim. The compact format supports a close, stable fit suited to cartilage positioning.

The diamond detail enhances the linear motif with controlled brilliance, offering light reflection without unnecessary bulk.

Diamond Durability for Cartilage Wear

Diamonds are valued for their strength and resistance to wear, making them suitable for fine jewelry worn regularly. When properly secured, they maintain clarity and shine even in frequently worn placements.

High-Level Features

This helix earring combines a pin-style silhouette with diamond detailing in a single-piece format. The focus is on clean lines, secure positioning, and compatibility with layered ear styling.

Product Information
SKU SHP-BODYJ122310053
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.02 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs About: Diamond Pin Earring for Helix Piercing

Is this earring specifically made for helix piercings?
Yes, the scale and structure are intended for helix placement along the outer cartilage of the ear.
Is the diamond pin earring sold as a single piece?
Cartilage and helix earrings are commonly offered individually for curated ear styling. Please refer to the product details table for exact inclusions.
Does the pin design sit flat against the ear?
The streamlined profile is designed to align closely with the helix, helping create a neat and balanced appearance.
Is a diamond helix earring suitable for everyday wear?
Diamonds are known for their durability, making them appropriate for regular wear when securely set and properly maintained.
How should I care for a diamond cartilage earring?
Gentle cleaning with mild soap and water and periodic inspection of the setting help preserve brilliance and ensure secure wear.