Handpicked 8 Carat Black Pearl and Diamond Necklace with Certificate

Regular price £918.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance the beauty of your neckline with this beautiful Tahitian Pearl Necklace, a classy option for any woman who wishes to stand out. With careful attention to detail, this pendant features a 10 MM Round Shape Tahitian Pearl in Bead Setting with a Leaf Motif at the top, studded with Round Cut Diamonds. Hanging from a chain, this Leaf Necklace represents purity and elegance, making it an ideal piece of jewelry for nature enthusiasts. Simple yet elegant in style, this Black Pearl Pendant has a deep, rich luster, creating a stunning accessory for someone special to you. The AAA Quality Tahitian Pearl carries a mysterious charm and symbolizes hope. Its unique design offers a striking contrast that radiates sophistication. The single pearl, celebrated for its rarity and beauty, takes the spotlight, making this Pearl Diamond Pendant a representation of purity and elegance. The classy design allows the pearls natural beauty to shine and sway from a chain, making it a perfect selection for those who value understated luxury. As a beloved and timeless piece of jewelry, this Nature Inspired Necklace boasts a style that, when combined with nature-inspired elegance, makes it a delightful gift for someone dear to you.

Product Information
SKU SHP-PENDANT0821352868
Length 21 mm
Width 16.3 mm
Height 12.5 mm
Metal Weight 3.45 gm (Approximate)
Total Stone Weight 9.14 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 82 Pieces
Total Weight 1.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-5 Pcs
Round-1.20X1.20 mm-25 Pcs
Round-1.30X1.30 mm-19 Pcs
Round-1.40X1.40 mm-9 Pcs
Round-1.50X1.50 mm-12 Pcs
Round-1.60X1.60 mm-1 Pcs
Round-1.70X1.70 mm-3 Pcs
Round-1X1 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
tahitian-pearl-necklaces